DPCstruct | MC13305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 10 aa |
| Standard deviation of domain lengths | 9.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5B2J2 | 1-135 | MLARAFDRPAFRTPFQQESNLPAFLQAVEDTIRVLSTGIWQTREGVEIHRLPSLHHIRDPSVRSALEATVRELDHLRRRYKTLLSTG… |
| A0A841PY96 | 376-521 | IQVRASKDLDEIILRTIAMAFARPAFEVPLHCETPNEFLQALKDSQKALRTGELVDRESRQVIRKAIGGYHELDDDQARLELGRIDK… |
| A0A7J5EUN9 | 61-193 | None |
| A0A7Y0IG09 | 162-308 | None |
| A0A495T8H0 | 292-442 | None |
| A0A2Z5FU89 | 39-173 | None |
| A0A430E2K3 | 3-119 | None |
| H1YE99 | 361-501 | None |
| A0A2D2AUL5 | 167-312 | None |
| A0A7Z6PUP4 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.