DPCstruct | MC13301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 243 ± 44 aa |
| Standard deviation of domain lengths | 43.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.33 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0023- CL0110- PF04031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1BST5 | 3-234 | VNFRHVAWASTDNFSVVAEALAKGDDASLKYASEVIGAWLTRLPPSKIPRSILCTYHLLVAYLENSDQSLALALMRFVSLLSSEDQD… |
| A0A316W391 | 1-257 | MTPSLPRRTPWTSSQALIALHGQLYSSDVFQRQAGLGIISLWLNRGPCPASVESTSALIRAQMLHAHLLPSPSDLASGYGDTSSTSI… |
| V5IJ06 | 29-263 | None |
| A0A7S4UR51 | 78-344 | None |
| A0A2J8AE81 | 1-282 | None |
| A0A7M5UPC1 | 1-132 | None |
| A0A4P9Y8L2 | 1-275 | None |
| I1CQS8 | 2-274 | None |
| A0A5N6PMP4 | 7-311 | None |
| B7Z381 | 28-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.