DPCstruct | MC133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842TKX9 | 5-99 | KIEDEDIEEIAKKINDAIFEGKDSVNIKGEDFEIEKYSPSGVRHVKIEPYLFLEQNPNKDSWHAKQAKKGKEILWVMKDYNYYARIM… |
| A0A532TGK2 | 2-90 | ESIKKNGITIYSALFERKKVVEIDDIEYPIKRFSSGIRYVDLFGYRYIEQNRNKKSEWGKKAREGHKIMWVIKGRRYMARIMDGEYV… |
| A0A0F9KC19 | 8-116 | None |
| D2W083 | 510-604 | None |
| R1EZR1 | 6-105 | None |
| D2VJ64 | 425-522 | None |
| D2VHN1 | 8-90 | None |
| D2W532 | 7-106 | None |
| A0A2V8Z6G5 | 1-79 | None |
| A0A2V8WBW4 | 15-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.