DPCstruct | MC13299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 223 ± 30 aa |
| Standard deviation of domain lengths | 30.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7L433 | 1-205 | MDNAAEEAKKNGLTIGKSLTKEQIAKLDKDIVWYEYQNVDGIQVLVPKIYLSKNTLKNLNNDSRSRITGIENTYVRTGNLENTGLIG… |
| A0A448VH65 | 8-218 | DPASTHKRLGDGYYEQRLVNEQIAKLTGYRRLDGYGSDEEQFKALMDAGITVAKQFNLVPGIALTSEQVALLTSDILWLENQTVTLA… |
| A0A0S4VAJ6 | 1-209 | None |
| A0A0P9I9Y6 | 217-413 | None |
| A0A6N8K9K3 | 13-187 | None |
| A0A1M5YSW4 | 161-397 | None |
| A0A561L5Z1 | 607-868 | None |
| A0A6M3ZNL5 | 4-191 | None |
| A0A6I4Q0G9 | 1-161 | None |
| A0A2A9JZE6 | 201-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.