DPCstruct | MC13298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 185 ± 35 aa |
| Standard deviation of domain lengths | 35.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.99 |
| Pfam Score | 80.59 |
| Assigned Pfam label(s) | PF15228- PF16922- PF05916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452Z8N4 | 9-114 | RECGEHNAQFQALIRKMVEQNLDIETTRNEDHYGAAIHHLSLLRNKRCLMAYMYNRAETIRSFRWKIGPVLPHEIQEKLNFSEKEYF… |
| A0A3M7R5T1 | 34-238 | QTGAKWIKNKKIRMFCQKSFELIKQLDSNFNSTHELSPFNEDNVRYTFEECKTLFAQNQIDVQPVLQGDNSNLPTIQMRHAALQRNK… |
| A0A835GY70 | 6-178 | None |
| A0A0K0EE25 | 604-817 | None |
| A0A099P5E3 | 23-199 | None |
| A0A654HC74 | 213-440 | None |
| A0A811MVS1 | 190-379 | None |
| C4JTP0 | 1-185 | None |
| A0A1Y2HTJ1 | 6-190 | None |
| A0A7R8X8Y7 | 797-1005 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.