DPCstruct | MC13296
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 410 ± 69 aa |
| Standard deviation of domain lengths | 68.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9IG41 | 3-467 | KTHPRLKPYNMLNDYERERYKEPVRESLKALLAIGWSVEHAEVDVPSTNRSSMRRSSKSQGDSANPFNYNPHPVDMTNLTLSREMQN… |
| A0A3M7R0W2 | 38-450 | NYGSLKFKIKKRRFIRFYEQLKYEDLTRDTLKAIKVLGWSIEKSETVPNNLKNASRMVLKKLKDGVVSNGYMPKPFDLSSITLTKEQ… |
| A0A3P7BZN9 | 2-353 | None |
| A0A3P7LG40 | 55-456 | None |
| A0A817MPA8 | 392-825 | None |
| A0A4Z2AZD4 | 139-635 | None |
| A0A3L7I0J8 | 795-1167 | None |
| A0A183R3A7 | 9-326 | None |
| A0A437BYD6 | 26-476 | None |
| A0A6V7X1X4 | 327-633 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.