DPCstruct | MC13294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5SXT2 | 5-73 | VESKLCELGSLEPREFPLTQREVVRRGKTCAIYFCLHGPRSVKLTAIADFKTRSMVFYGSDGVRRETVR |
| A0A5B9R217 | 8-89 | RIDFTQLRKMVASMLAELGQLEFDAFPMTERVVVKKGEACGVYFCLHGPRNVKITAICDLKKRTIIYYGSDGVRAQQASIPA |
| A0A7C5FZM9 | 8-90 | None |
| A0A5C6AJB5 | 12-100 | None |
| A0A517T4N3 | 27-101 | None |
| A0A2D7HM32 | 1-98 | None |
| A0A3E0P6S5 | 47-128 | None |
| A0A7V4PBT2 | 1-85 | None |
| A0A3L7VG45 | 7-85 | None |
| A0A3L7P441 | 26-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.