DPCstruct | MC13293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 20.13 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 46.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6F015 | 31-140 | RLVLVAAMALAAVAAEAHHPDFENQPVRPRVDVIGPIGNRLPSSYRRKYNRPTNFGGWLAYHVAPSSQEAMAWHDATHRDAYKCDRP… |
| A0A5B9QXD7 | 2-113 | RCVTVLLLLFASTPLWAHHPHPHTPPVRERCDPIPPLGNRLPPSYRRVYNRPTYLGGKIAYYIAPSSQEAMSWHEHVHRGSYRNKAG… |
| A0A7D8Y8Y7 | 17-138 | None |
| A0A5C5ZAY2 | 2-118 | None |
| A0A518JM58 | 2-133 | None |
| A0A518HR03 | 89-229 | None |
| A0A5C6A2S4 | 24-176 | None |
| A0A7Y2AI07 | 1-176 | None |
| A0A142Y9R8 | 20-126 | None |
| A0A5B1CCG9 | 9-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.