DPCstruct | MC13291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 8.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.95 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B9QSI6 | 1-84 | MTKDHGPSIKDDEQYEALRDEGMSKEKAARIANTDRQAAGRRGGNAQTYDDQTKQELYDKAKDVGIEGRSKMSKDELIEALRDH |
| A0A1H1KUN9 | 344-436 | GTPEEGGRDARSEHQGRELYEKLRDEGNSKEKAARIANAAARDGRSAVGERGGEADSYEDRTVDELRERAKELGMEGYSHLKKAELI… |
| U2HPR5 | 31-112 | None |
| A0A2T8F9D7 | 402-492 | None |
| A0A291QMS4 | 5-106 | None |
| A0A7H1BGQ4 | 38-125 | None |
| A0A4Y3QJ43 | 109-207 | None |
| A0A1H9SP48 | 49-157 | None |
| A0A542UYL8 | 93-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.