DPCstruct | MC1329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 3.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 68.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D9E5K2 | 4-54 | QQQLANSAAIRAEIQRFESVHPNIYSVYELLERVDEPALQGQLREHVIAIE |
| A0A1B0CG73 | 1-57 | MNSRPLQSFLTNSLAIRQEIQRFESVHPSIYAIYDLIELIQDQQIAQQIRDHVVCIE |
| A0A6H5H564 | 37-96 | None |
| A0A2R7VT80 | 1-60 | None |
| A0A1B0GNY5 | 1-58 | None |
| A0A182WH52 | 4-61 | None |
| A0A1V9Y2S8 | 20-67 | None |
| A0A067QUE3 | 1-58 | None |
| A0A060WG02 | 49-107 | None |
| A0A336M832 | 33-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.