DPCstruct | MC13289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 362 ± 48 aa |
| Standard deviation of domain lengths | 47.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3CHN9 | 1-345 | MTPVDYTVKSLKEGSIRFAAEQPENGKNHPRNLFIWRSNLLGSSGKGHEYMLKYLLGTENGIQGKDLGKQGGVKPEEVEWRDNGLDG… |
| A0A1S6LMZ1 | 28-365 | MIQTAYWYLHTDQFRYDPFSADTLAAAGAGGTFAGKSTADVIAASARMGWMPSYPTSDRNPLTLATDAGAAGQEVPEYVVDELKAGR… |
| A0A3S4JIB6 | 43-338 | None |
| X7YBV1 | 555-919 | None |
| P85097 | 402-700 | None |
| S7SSX3 | 5-445 | None |
| D4DNV1 | 11-374 | None |
| A0A379UPU0 | 2-337 | None |
| A0A378F4Z1 | 166-531 | None |
| A0A7C5L3H1 | 2-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.