DPCstruct | MC13288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 195 ± 35 aa |
| Standard deviation of domain lengths | 35.06 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3I5P7 | 366-500 | SISELTVRVKEAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPAGLLTVQKLYCLIEIVHSDLFTQHDCREILLPMMTDQLKYHL… |
| A0A4U5VMQ2 | 636-798 | TSFNDMMNSNSENTGMVKGAALKYIPTIVNDVKLVFDPKELSKLFTEFILKVPLGRLVKQKLDCLIDIVHSDLFTHHDCREILLPLM… |
| A0A2R7W8W5 | 215-398 | None |
| G3IDC5 | 18-218 | None |
| A0A6I9YXH7 | 2-187 | None |
| A0A0R3S2B9 | 945-1145 | None |
| A0A821RRP8 | 600-822 | None |
| S9WYG2 | 6-180 | None |
| A0A815KG31 | 31-304 | None |
| A0A1S3QES5 | 219-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.