DPCstruct | MC13287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 424 ± 117 aa |
| Standard deviation of domain lengths | 117.21 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 99.19 |
| Assigned Pfam label(s) | PF02990- PF00687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446U1D8 | 2-316 | ERDVNEESGWKLVHGDVFRPPRSLTLLSALVGIGTQLAALILLVIVLAIVGMLYVGRGAIITTFIVCYALTSFISGYVSAGLYSRNG… |
| A0A4U5VB84 | 638-1069 | MQTTYCEIDLDKAKRDAFVYAIKNHYWYQMYIDDLPIWGIVGEADENGEDHYLWTYKKLEIGFNGNRIVDVKWKKSDVKFEDRFDKY… |
| A0A540K6D1 | 2-304 | None |
| A0A7J6UP04 | 4-315 | None |
| A0A6V2HM70 | 69-500 | None |
| A0A6A5DG29 | 90-505 | None |
| A0A6G1LS92 | 41-439 | None |
| F4Q874 | 319-841 | None |
| A0A813TSM1 | 105-615 | None |
| A0A7R9U9V8 | 385-830 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.