DPCstruct | MC13286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Standard deviation of domain lengths | 15.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.66 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0041- PF03441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5V2F7 | 160-279 | RAILTTNSTMVLLPTGHDKHCSAIMSAPLQTVLDNLDVLEELVILLDPEGHAVKNTKHLASLCSFPATWITYTYSMKDSKSPLKAVL… |
| A0A3P9H2Z8 | 116-212 | VLSAPVQTVLDDLDVLEELVILLDPETQGKKNTKHLASLCSFPSTWITYTYSMRDSKSPLKAVLEGISSKHPDWTVGHLAKLLKQMD… |
| A0A7N4NHV3 | 136-266 | None |
| A0A6I9K926 | 162-291 | None |
| A0A2A3EJC7 | 2-104 | None |
| A0A6P8HXH1 | 579-693 | None |
| V5N6J3 | 27-146 | None |
| A0A7J8B960 | 97-216 | None |
| A0A7D9LLL2 | 1-140 | None |
| A0A6P8TFH4 | 1-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.