DPCstruct | MC13285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.98 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3DJJ0 | 3-88 | IAAPLDLSFKKATTMNELANKRPQAVRTGKIPLRTAADRFVTCSLWLSNNSLTSMFGFENLAQKLLDDPSHLSWLDLSFNEIEQIA |
| A0A4U5V0H7 | 2-86 | YGAPVDLSFKHISSLADSWKEEPSSGLRPLKRNSEMKYLSRSLRLSNNNITDLCDLQRPVSHFLAEPSQLAWLDLSFNKISHIDQ |
| A0A177AU39 | 1-101 | None |
| A0A820XBG7 | 24-107 | None |
| A0A6J0WNQ7 | 1-95 | None |
| A0A5K4FAL3 | 6-103 | None |
| A0A7J7F920 | 2-89 | None |
| A0A6P8RJR2 | 13-106 | None |
| A0A2S2QMC0 | 18-114 | None |
| A0A2Y9I8U7 | 8-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.