DPCstruct | MC1328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 3.38 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1WL45 | 1-65 | MANALVDIPQAEWSELRELYVGQKKLASAYNTLQCLIDWKTQDDELEINIYSLNGDWRSDGTFVA |
| A0A1B0CFB9 | 1-70 | MSKDYLVEIPIDKWVELRDMFNGDWPKNIVNYFTIDNYIKWREKSNEIANLHFYSLNGEWKSDATVLIVV |
| A0A084WFW5 | 2-70 | None |
| A0A182YN60 | 1-70 | None |
| W5JLD0 | 3-71 | None |
| A0A182WFH1 | 1-69 | None |
| A0A811UKC9 | 29-103 | None |
| A0A182QQ73 | 410-479 | None |
| A0A182V9H4 | 4-79 | None |
| A0A182P498 | 7-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.