DPCstruct | MC13273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 97 ± 9 aa |
| Standard deviation of domain lengths | 8.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M4AUF7 | 11-108 | GNNIEKKGSDKSQDQIILGKWECTFSGYESIISLYQIGNKFFTIIDFTKNNSRTKKETLQKKGKKYFVVNSTANEYYIINNDGNLEL… |
| A0A7Y5CXX3 | 123-219 | AYRAQAASDNRNRVGVWLTSPPALPGRLTIYRDANGKVFAEWQLRSGQTTTDALIETRSNRGRRYDITGGDGGYYQLGANGSLELGN… |
| A0A7U7HDM3 | 13-123 | None |
| A0A1H9MCR2 | 2-97 | None |
| A0A3R8Y794 | 143-234 | None |
| A0A7W6Q892 | 1-119 | None |
| A0A8B3C6Q1 | 134-231 | None |
| A0A1G0RDB5 | 114-208 | None |
| A0A7Z2QY77 | 10-81 | None |
| Q5QZV8 | 2-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.