DPCstruct | MC13271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 77 ± 3 aa |
| Standard deviation of domain lengths | 2.87 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6P1L7 | 60-135 | TISALLFLIDNGRELSFLYNDIEYSITWKDKLLYLDNEKHDNLQMFDNAWELIENSKIEKYKFLEVWNDIKLLTLF |
| R7G8Q7 | 140-211 | DFNDFIEALYMYSEMLFKHDGTLYEVFIRGDDTIVFCSDEMEQEFTSKNDFINESHIGSRLLKDIWNEVTDV |
| A0A0Q4RBW7 | 416-495 | None |
| C0E9E9 | 373-450 | None |
| A0A5C9ASL3 | 4-79 | None |
| A0A829R3Q9 | 2-82 | None |
| A0A349YPJ6 | 87-161 | None |
| R6WUK2 | 319-395 | None |
| R7BDR7 | 2-80 | None |
| A0A7D3XQW5 | 14-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.