DPCstruct | MC1327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08293 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K6TD35 | 2-85 | SLLSEYALLMSRLSARLFGEVARPTDSKSMKVVKLFSELPLAKKKETYDWYPDHHTYSGLMRTLRLLGLYRDEHQDFMDEAAKK |
| A0A1B0CEE5 | 189-288 | VNLTTPYARRMQYLSNRIFGEVARPTNSKSMKVVKMFSAKPVEKNDYYVNYYPRHVEVGWLMRHLRSYGLFRDEHEDFKEEMKRLRA… |
| A0A1Y3EHH8 | 10-112 | None |
| A0A1Y3BPP6 | 13-141 | None |
| A0A654H6L7 | 53-178 | None |
| T1KRY4 | 3-120 | None |
| A0A6I8S4H0 | 290-398 | None |
| A0A0N4V387 | 267-387 | None |
| A0A1I7WCS4 | 16-114 | None |
| A0A6H5IFG0 | 7-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.