DPCstruct | MC13268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 26.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01937 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6RT30 | 15-159 | CNSSLPPILNGIKEGTFVTYTIAERWPKTLAKVVDHVHCKRKEFMEQYGPEADADVKSIIHELSELRYRIMTDKPLEDLTDTAYHYD… |
| A0A7M4G340 | 39-177 | MAASVAVSLSGRFKGSFAYFTIKDRLPQILTRVIDTLHRHKNEFFEKHGEKGVEAEKRAISFLSKLRNELQTDKPMIPLSDELPDTP… |
| F8NLE0 | 106-284 | None |
| A0A1J8PN97 | 387-550 | None |
| W4KLE3 | 5-168 | None |
| A0A4U0W076 | 5-150 | None |
| A0A7S4E5W3 | 291-427 | None |
| J4UCZ9 | 57-204 | None |
| A0A670IX52 | 13-126 | None |
| A0A0N0PD01 | 54-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.