DPCstruct | MC13266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 127 ± 24 aa |
| Standard deviation of domain lengths | 24.36 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09643 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I2DTT2 | 1-105 | MVKVKAKDKECWKIWHYGTMESPSVMKVNGCSVAVVPRTVCESTGLTCKGREVYENDWLAVEGDGETHKFLVAWGETEFRAFEDETI… |
| E0NZK3 | 21-143 | LEMREIKFRAWDSAKKIMRSVANIYTHSRSVFVLVREAAGGPPELIRTECLMQYIGAKDKNGVEIYEGDILLDDFAEEYYIVKFFDG… |
| A0A2N2WCB1 | 43-166 | None |
| A0A4Q2FAR1 | 2-120 | None |
| R7BKE9 | 2-130 | None |
| R7BGS2 | 66-181 | None |
| A0A7C6S1U9 | 2-105 | None |
| A0A357NGQ1 | 51-209 | None |
| A0A4U3MJA2 | 54-182 | None |
| A0A841TAA5 | 3-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.