DPCstruct | MC13265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 120 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B8M8I4 | 2-112 | RSLDDVGQGKAVGYLPLATLKNVLRISADKIRESCEARGLNVKIFDEDSSCIKSGAIFVYDTGLVRGIIDRFDQDILARGWSGDVES… |
| A0A420B3H6 | 17-127 | RSLTEVGPSKPIGYLPLYTIKDFVQLSPQTIAAAATARGLTTAQFSPKECCIKSGALYVYHREALASLLQARAEVITAGGLPLDPDR… |
| K5ZL99 | 2-95 | None |
| A0A1F7J3Q1 | 7-143 | None |
| A0A651FQS7 | 3-134 | None |
| A0A7T5RGQ9 | 1-134 | None |
| A0A7C7SPJ1 | 3-101 | None |
| A0A1F2YQE7 | 1-126 | None |
| H0HEN9 | 1-127 | None |
| A0A839W742 | 213-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.