DPCstruct | MC13263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 49 ± 4 aa |
| Standard deviation of domain lengths | 3.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 63.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318V5V9 | 1-51 | MPRSRKEQVSLEDTPYYHCVARCVRRAFLCGDDPATGNSYEHRRGWIEKRL |
| K7AJY7 | 1-57 | MPQSRKTHVSLIDTPCYHCVSRSVCRSFLCGKDKFTGQSYEHRCGWVEERLLFLLSV |
| A9KVK4 | 1-47 | None |
| A0A6B2IPP1 | 1-44 | None |
| A0A3N1PS37 | 1-46 | None |
| A0A2A4W9V1 | 1-53 | None |
| A0A8A5EEE5 | 1-46 | None |
| A0A0C5VCW5 | 3-49 | None |
| A0A1N7CV16 | 1-47 | None |
| A0A095S6Y0 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.