DPCstruct | MC13258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 364 ± 32 aa |
| Standard deviation of domain lengths | 32.09 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E4R7Z8 | 1-421 | MATYTGLKSLHDYLSLIDIPDGLHSIDIDGTLININIINKIESYIYDGVEQFGNDIDDGPLTILNIKGDLTINEGQTLRPKKRCKGF… |
| R6I0P1 | 125-497 | KTESLISKISEIQSNGYSTVKLKVKDNEGTEKIVEYNIHTIIYNGNLILDGISNIEGATLSNNVYEFGSKTTDVATENENAKNMVVL… |
| A0A1I3T6J9 | 1-356 | None |
| A0A7C6CBW7 | 563-917 | None |
| A0A1Q6LAX1 | 232-596 | None |
| A0A1V5WYJ5 | 3-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.