DPCstruct | MC13253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 209 |
|---|---|
| Mean domain length (aa) | 209 ± 30 aa |
| Standard deviation of domain lengths | 29.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.37 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | CL0328- CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5WHP8 | 15-243 | SERLPRGVIRYQWVYLWHWPIRAMHWIAALCIVVLVVTGFYIGAPYFLTAGEPSGHYLMGWARFLHFAAAGVLVATGIVRVYWLFKG… |
| A0A5Q2MXW8 | 4-210 | SKGPMVEKFPLDQRVVHWIGSISFIICALTGLLLFTTALDFLAPLFGGKATAGRIHLISGIVFAITPLIALIWNGKNLIHFLRDISH… |
| A0A0F8MGC9 | 2-224 | None |
| A0A1F9K192 | 2-210 | None |
| A0A351G850 | 71-300 | None |
| A0A1V5RWY4 | 11-231 | None |
| A0A3M1EGQ9 | 4-224 | None |
| A0A2U1S1B1 | 51-240 | None |
| C5AHU2 | 13-214 | None |
| A0A3A4Z1T4 | 3-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.