DPCstruct | MC13252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 129 ± 14 aa |
| Standard deviation of domain lengths | 13.87 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8SFI3 | 47-162 | ERLDQAVLLRASLELPSDEATVRALLLSPTTRLFQGIIPMSPQEFAAFTGRGANIDLVGPVVRHYGEEHPDEWAGYYVDDDTGVVVA… |
| A0A366ZNH6 | 1-126 | MSPPDDASPTDAESHEIQLRSMFGLRADLSYVRAVDADPESTTDQLGIPLTPDEAADIDARSALGPTVRALVAAAEDLDGYGGIWID… |
| A0A1F8S2B3 | 21-150 | None |
| A0A024P8Y6 | 9-131 | None |
| A0A1L3MVM3 | 28-163 | None |
| A0A840PXQ0 | 1-165 | None |
| A0A7W7H0G8 | 56-178 | None |
| A0A433R8Y2 | 2-120 | None |
| A0A553KSC1 | 38-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.