DPCstruct | MC13250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 192 ± 19 aa |
| Standard deviation of domain lengths | 19.09 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04434 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1EG63 | 1-186 | MSLATLIATHDEDALAALANAGIVKRAIRDLAAGKAVIESFTGDLAVVTIGENTVRFTGSALQASNCTCSATSVCRHMVLAVLALRA… |
| A0A1Q4RY74 | 4-189 | QDLLALTTDDLTVLSNRGLVKRAFKELEEGELSYDITQDAQGNISIRWSDVECVLPATEELSDRHCNCSATTVCRHLIRSILIYQRT… |
| A0A838IEX4 | 9-174 | None |
| A0A2D8JXI5 | 10-241 | None |
| A0A222FK39 | 1-181 | None |
| A0A7Y4L5B2 | 6-198 | None |
| A0A0J1DC50 | 2-205 | None |
| A0A5S3X2E7 | 1-166 | None |
| C0B284 | 1-173 | None |
| G2DXX7 | 1-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.