DPCstruct | MC1325
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 233 ± 35 aa |
| Standard deviation of domain lengths | 34.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8RK94 | 1-192 | MLYQLQTIKPENFSVNCSLPNENQTNIPIHQLNKSQLYSAPIDPTEWVGLRKSSPLLVYLRNNLLMLAILAFEVTIYRHQEYYRGRN… |
| A0A1B0CBS1 | 36-260 | CVKEPCFLHIFFTAIIVIAALSRTDSQILISRIFSVIVAVLFLAKMIYQVKYIEHHNYDVICNNVTNPNGINNADWFGFHKISENST… |
| A0A815NVY6 | 93-305 | None |
| E7FD74 | 746-1016 | None |
| A0A0D8XPP7 | 4-216 | None |
| A0A0N4WCJ0 | 3-215 | None |
| A0A7R9AWQ2 | 453-695 | None |
| A0A183TW26 | 429-644 | None |
| G3NS86 | 122-406 | None |
| A0A3B3YH69 | 2-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.