DPCstruct | MC13249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 453 ± 71 aa |
| Standard deviation of domain lengths | 71.40 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847VFZ2 | 1-434 | LYPYRPAHLLLRHELDELFDTSADLSGADVDVSRFIRSGDERDLSVFWSEVPKGETPGADRRADRDALCAVPFLAARDWLCGKETGS… |
| A0A1F0MWH0 | 6-379 | PQTQEATVELLEALPPRAEEVFPGSISTVRDLAVKLQQDSEERHAATLLLVYRAGDIELLDEPNEIKPGDTLIVSDQLPFTTQGVLT… |
| A0A2S9YMF1 | 78-583 | None |
| A0A7X7KQ99 | 234-770 | None |
| A0A7C5YYW3 | 1-260 | None |
| A0A4Y8PG17 | 255-721 | None |
| A0A7X4CLF1 | 8-396 | None |
| A0A7C5VIS9 | 7-457 | None |
| A0A3Q8HV27 | 32-464 | None |
| A0A2W4LHV8 | 15-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.