DPCstruct | MC13248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 13.28 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9Y4S4 | 9-135 | SIIPFLLISSKSIAQIDTLNYLKQFEINKAQFINQPFSHLLNHITQIQPKSHWAHSSMKNKYIVKASTFNFCQMDYSFKNAVTLRIT… |
| A0A1Q3JQT2 | 10-140 | FLFSFATAQAQTQPVTDTLAYLKSIEARKAEFVGQPFSKLLNELKINIIKFGPIGSNSNDITQEPTTVFRFKRPIASQDYLDFPSIS… |
| A0A543DT94 | 21-151 | None |
| A0A1M3L519 | 6-136 | None |
| A0A1Y4AMI0 | 13-152 | None |
| R7DXD7 | 19-149 | None |
| A0A8B4Y871 | 1-112 | None |
| A0A351YG41 | 17-147 | None |
| A0A1I0RJ87 | 29-153 | None |
| A0A1K2IVE1 | 10-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.