DPCstruct | MC13247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 640 ± 62 aa |
| Standard deviation of domain lengths | 61.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 15.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2IZF9 | 597-1172 | ARLNIGNLEKTDLSEIKFNKIFEKEFDLENTESENRREFFHKMIRQIQSEQGWKNFVSFKLEAPQQFYMNTELRTVCDQSVRICKIE… |
| A0A6J1R8W1 | 11-668 | LRINIAYDNLEVNALNKQSREMDPAWGVPLPSNKPNSTERKNQIMQSLARGLQSGKVYVFDMNYNVPTSEERQVLSAGFVRSNLDRK… |
| A0A0P6CYT5 | 3-595 | None |
| Q9U572 | 1062-1670 | None |
| A0A444SBK4 | 556-1123 | None |
| T1IVN0 | 163-769 | None |
| Q16927 | 1412-2167 | None |
| A0A1S3JGR0 | 273-950 | None |
| Q9U8M0 | 1183-1896 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.