DPCstruct | MC13244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Standard deviation of domain lengths | 7.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3VKK7 | 1-104 | VASVILQSVNGTQTELQISGGENLNPFLLNPTLCANVVLKVSFVIMYNPAGEIANVTLSVVLGFVREDALPLQQEFHIKFVQEEVTV… |
| A0A1L8I142 | 389-489 | ITVQSLTKKSINGIFIPSVIDNYVPVLDNTTGLCKDVVLGGSYQILYTELGEITAVNAFLTLGVIDSTLGPVQQNFKVSFVQDGTFP… |
| A0A6J8EWC5 | 225-327 | None |
| A0A4W3HZC0 | 99-218 | None |
| A0A2R9AHW5 | 216-333 | None |
| A0A671T839 | 7-124 | None |
| A0A3Q1G708 | 69-179 | None |
| A0A671PSM8 | 26-128 | None |
| A0A1I8GC73 | 101-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.