DPCstruct | MC13243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Standard deviation of domain lengths | 22.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11594 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7SQD8 | 1-160 | MAMPSNERNNEHNLIDELETAFQNCLSLLTSQEYFNVTDSEETKAGIEHALQRFLEVGRQMEAFFLRKRMILSIQKPEQVIKEEFTD… |
| A0A7J7K7S9 | 1-123 | MAEPSLKPLEPTGTIIDEFEDAFHSVCKYLDQIDDKKPQMEDIKRDADVLVSRFIDAGRTCEQYFLQKHIQIANAKPEQVLKEECNE… |
| A0A6F9DKS5 | 27-156 | None |
| A0A813M796 | 5-181 | None |
| A0A226EP79 | 1-163 | None |
| A0A182TVM2 | 1-200 | None |
| A0A6J2TLE3 | 1-172 | None |
| A0A553NSK2 | 61-228 | None |
| A0A7R9LBU0 | 1-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.