DPCstruct | MC13241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1R6W7 | 1-119 | MTNQMILIFFLLQKVHTCGMCETILEEQEIPSHECWANYPGIVCDENTLYLYPQCENGDIVCRSAIDGAELFVTKSHLPTSEELLTP… |
| A0A6J1QN00 | 3-131 | ESNKENENDDVFDLPVQTCGLCETICDADYINQHECLQGYPNYYTDPNTYYFYPMCEDGSILRRSAIDGQEVTVQESLENITNKRKN… |
| A0A0J7KNM1 | 2-113 | None |
| A0A6J1Q2Y6 | 3-99 | None |
| A0A151IM46 | 1-125 | None |
| A0A151WN59 | 20-145 | None |
| A0A151IDZ5 | 112-241 | None |
| A0A6J1PPP7 | 1-113 | None |
| A0A151JLQ5 | 1-138 | None |
| A0A151JQU1 | 62-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.