DPCstruct | MC13240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 186 ± 29 aa |
| Standard deviation of domain lengths | 29.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 32.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1QMK4 | 15-189 | EYSVASDVSVVDVYDIASEIGKECEKLIDLFGVESVTNLMPKVINALELLENLATKNERENTMVQELSAKISQLESDKIGKAEDRQR… |
| A0A816ACG9 | 65-244 | ANLTVLDVYDEAALIGKDFERIIEAYGTETIRDLVPKVIRILELLELQAAKNEKETDQLMEMKTRIERLEIEKSETREIREKFDQEL… |
| A0A819TPN1 | 1-244 | None |
| A0A1I8HP26 | 1-195 | None |
| A0A443R141 | 2-219 | None |
| A0A194R195 | 1-200 | None |
| A0A816R1X3 | 40-238 | None |
| A0A0R3T7E4 | 5-137 | None |
| A0A0K0DXG3 | 24-212 | None |
| A0A183N3R9 | 61-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.