DPCstruct | MC1324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 177 ± 23 aa |
| Standard deviation of domain lengths | 22.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9BY74 | 8-172 | GGHREMMEVVDESGGHREMMEMLGNTLMAMLNKYWIYICGGMFFFVSFEGRIVMYKIIYMMLLLFCVACYQVHYEWWRRMLKYFWMS… |
| A0A1B0CBS2 | 13-174 | ESQFITKAAILFDAFLTRFWIWIVVITLFASGIAGQRMTGFRIIYMALFLVFLLTFQVSWKAWKKMMYGFWLTVIIYAMVILVLVYT… |
| A0A6I9MZX9 | 2-146 | None |
| A0A2A2M0E5 | 575-742 | None |
| A0A183T6D2 | 732-893 | None |
| E7FD74 | 525-696 | None |
| A0A1I8IUL1 | 213-393 | None |
| A0A3P6TBY3 | 126-307 | None |
| A0A4U5LX49 | 2-162 | None |
| A0A1S3M1P2 | 315-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.