DPCstruct | MC13238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 209 ± 22 aa |
| Standard deviation of domain lengths | 21.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17104 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O42882 | 145-325 | WQDDFQDAVNSVFGLPETPKTIEESSLDPDRILSLWQKLIEMPVLQRPDWLRSSIRHIFLVTMGLPVDLDELLPTPSTQGSFNSSRT… |
| A0A317SYQ1 | 5-197 | DKGKYQNIAPIPIDDSAFLTERSLSLWNQLSAPPPLQPPNWKMSRIRRLFLVSLGVPVDLDEILPAETKQKKLILPSVNIARKSVDG… |
| M1W6L1 | 395-619 | None |
| A0A397GYS6 | 350-591 | None |
| A0A4S9N0A2 | 285-488 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.