DPCstruct | MC13236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 14.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015IT90 | 30-164 | MDDQTIGGSEIKEVVLSSGEISVTTNIIEKGTNGADKYTEGIGHFTINYDKPNGKHVSVRILKKGEMVNYHDCSGNIDPNEVNPFTR… |
| A0A397W4L4 | 20-142 | GTAHSCLVMISNITWYPGILEITVDTCGFAPQALGHFTFHDDSGHNIRFFSAPQFVNCQHCENSESCQVTGQYTSNWTFDASQTPQN… |
| A0A015K3E3 | 7-149 | None |
| A0A2Z6RVB9 | 9-128 | None |
| A0A2I1GUA4 | 5-111 | None |
| U9STG2 | 3-104 | None |
| A0A2I1F388 | 5-130 | None |
| A0A372R7J3 | 6-151 | None |
| A0A397U0P8 | 47-178 | None |
| A0A372RWP8 | 32-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.