DPCstruct | MC13234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 15.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397W1A7 | 263-390 | LKEERSMKDLQLVGFKELKLRSFDNYANALKMIINIPSLNNYLKQNVIPIITDWPGQLFIRKIITYLKIQQSASNILQVYKNFHSII… |
| A0A397U4F4 | 236-364 | KLVDLKEGSLHTTVEYVDALRVLIDIPEAETYMKTQVLIAPMDYPGQLNVCRAVTRRIKFGDSSGIPEQILHVVPMIGPLHVSLNSR… |
| A0A397JHZ6 | 366-487 | None |
| A0A6S7G6B0 | 60-226 | None |
| A0A397JRQ5 | 568-691 | None |
| A0A397JUH7 | 2-97 | None |
| A0A2N0QYW4 | 257-381 | None |
| A0A2N0R0H5 | 36-174 | None |
| A0A6S7G8H9 | 6-130 | None |
| U9TN26 | 22-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.