DPCstruct | MC13232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1286 |
|---|---|
| Mean domain length (aa) | 201 ± 38 aa |
| Standard deviation of domain lengths | 38.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.46 |
| Pfam Score | 98.11 |
| Assigned Pfam label(s) | CL0710- CL0229- CL0221- CL0214- CL0385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1EKH9 | 382-622 | QDDVHECLVCFDMFSVRDLVACPGTNPHYMCRDCFGGEVKAQVGETGAFAAHRQRIFCNLGCGPGLYFRHEVVVQSINSEAREAFYA… |
| A0A397VZW4 | 4-189 | TNKCSTCSVCYNSTSEYPLIVDSCVHELNICRDCVVRHIQSDILKGNIINIQCPSADCEATLSYNDIKRLVPKNLFERYGLFLLRHV… |
| H3AW13 | 2-159 | None |
| A0A199VX72 | 79-242 | None |
| A0A199VSD5 | 175-416 | None |
| A0A814T4X9 | 588-810 | None |
| A0A1U7WCF4 | 128-325 | None |
| A0A1I8IR93 | 681-906 | None |
| A0A1I8I302 | 3-227 | None |
| A0A0K0EC55 | 59-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.