DPCstruct | MC13231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 189 ± 40 aa |
| Standard deviation of domain lengths | 39.69 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 15.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397VVZ7 | 2-175 | PNDVEDAFEYVNNVQTYILHIHGPLINEQKARVDITDIKPFFDVIVPDNEPLSIFKPRLVKIILGAEKIDKSKFGMKVVHAYPIRGY… |
| A0A2R7KES9 | 7-117 | GFVLTRHWRDTPAGTEVEFWLATDAGPRRVRLAPQTSVAFIPAAQREAAERLLHDEKHVELRPLALQDFEHRPVLGLYCQQHGQLMR… |
| A0A2H3BU34 | 130-302 | None |
| L1LBM0 | 175-488 | None |
| A0A5K4FAI1 | 5-233 | None |
| A0A5N6PAW4 | 81-266 | None |
| Q74N74 | 22-170 | None |
| A0A2R7QAI0 | 19-144 | None |
| H3AKZ0 | 297-544 | None |
| A0A836ASS6 | 298-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.