DPCstruct | MC13230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 132 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 40.00 |
| Assigned Pfam label(s) | PF05038- PF08507- CL0265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5B2C9 | 3-135 | ALIWYEWARLLALTSGAYVAWAAMWGFFYRKYFWDFVGGSLGPHGIEPPSGAAVFVKLIVDLPVFQIVNLVNGLLTLALEWPLPHIK… |
| A0A397VV63 | 4-125 | LIWSQWARLIALTAGVFETIGGIFGLFYRIFTFEPLTSDLNPIFNPINIIAILCIFFGFIIVAIEIPVFPFKNTFVASSFIPRIILY… |
| A0A225B162 | 1-136 | None |
| A0A5N6TN00 | 4-147 | None |
| A0A4Y9YV90 | 556-694 | None |
| A0A507D493 | 687-797 | None |
| A0A1V6SVY9 | 1-133 | None |
| A0A6A6ZJ72 | 3-118 | None |
| A0A507DXD7 | 13-141 | None |
| A0A094HVC9 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.