DPCstruct | MC1323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 381 ± 42 aa |
| Standard deviation of domain lengths | 41.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9QWP3 | 2-358 | EQNKIVPDVIDTIPQNIIQVHYPSGVDVNMGNELTPLSVKDEPTVQWSAEEGVYYTLVMVDPDAGRNPQIKHWLVVNIPGNDVSKGE… |
| A0A1B0CBQ8 | 193-573 | QSSEVVPDVVASVPNKPIEIKYPSGVEVNFGNELTPTDVKDIPYVTWDANPDDYYTLIMTDPDAPSRKEPTFREFKHWTVGNIPGNR… |
| A0A0N4W5V5 | 86-432 | None |
| A0A7R9KUZ2 | 4-442 | None |
| A0A6I8UQ17 | 2-415 | None |
| A0A1J8PT18 | 220-608 | None |
| A0A2A2J9A5 | 2-342 | None |
| A0A2A2J9S9 | 1-318 | None |
| A0A1S3D4U3 | 2-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.