DPCstruct | MC13229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 14.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397S7U2 | 87-233 | NPSKLSVFSPKNRELKVNCIKEPITLQPDNSYYSIKTSGQLSQGDTVFVNIYCSTTNYELINIRLIGWSKNCIYFRLVKPKNDSDSL… |
| A0A397VUW4 | 51-189 | KPSLVGAFSENQRETDIDFHNAFVDLTTCYDDIIFIPLSFALSKNCIILFSTLYSANNPPEQNFKLIRWSKDVLELKITKLNTNQTQ… |
| A0A397S1H8 | 783-902 | None |
| A0A372QHD9 | 1-147 | None |
| A0A372QMR0 | 1-121 | None |
| A0A372QN51 | 311-457 | None |
| A0A2I1EQC1 | 934-1103 | None |
| A0A2Z6RDD9 | 245-359 | None |
| A0A2Z6RP77 | 1109-1240 | None |
| U9T7L8 | 225-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.