DPCstruct | MC13227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 19 aa |
| Standard deviation of domain lengths | 18.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015I629 | 1-117 | MPDKVYEWRKFLQNLVENFEMFFADELSGAVDALSSEEFGVFFDNLEKGINKALEHFEKWFLSWLHLPLVICHLGGDNGKSFASSFH… |
| A0A397VT39 | 1-152 | MPDFIVRKTMKLRNIVEDPYLFFEKELLENINLLEDHQLNELILDLERGTKKALELHQKWLDCWLHLLLSICHLGVKYGHEFARSFA… |
| A0A372QES5 | 1-103 | None |
| A0A372Q6G4 | 1-117 | None |
| A0A397VCQ0 | 81-195 | None |
| A0A2N1MTP9 | 9-170 | None |
| A0A2Z6R9H1 | 121-248 | None |
| A0A397W4Y3 | 6-130 | None |
| A0A397VZ19 | 1-106 | None |
| A0A397VTI3 | 275-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.