DPCstruct | MC13226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 75 ± 2 aa |
| Standard deviation of domain lengths | 2.21 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 48.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9TNP7 | 9-81 | YEIKINIYKYIDFPLNLALTCRNWSVISKDAYAKTEWLLVRYGKSHALFQAVRLGPTFIDIPVCKTLITRKVP |
| A0A397VRC4 | 96-168 | YRLVDEILINIFQYVEFPLNIILTCRNWYKISIDQQARAKLIIYKYGRAHALFYAVKFSPNFINLPVARAIIA |
| A0A397SD37 | 6-78 | None |
| A0A397JKA1 | 10-81 | None |
| A0A2I1GU06 | 1-77 | None |
| U9UJW8 | 1-74 | None |
| A0A2I1GJA0 | 1-77 | None |
| A0A2H5R695 | 1-78 | None |
| A0A2I1EQ50 | 1-78 | None |
| A0A2Z6QGC0 | 28-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.