DPCstruct | MC13224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 171 ± 28 aa |
| Standard deviation of domain lengths | 27.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397TQF7 | 21-172 | ILNQLLKKYNLSAESTPEQLSKHASEFGVSLPDWMARKCVKDALTRRKFSKEQIEALMPDKRKEKLTIEERAKYCVKTGDKWDIFIH… |
| A0A397VHX2 | 1-187 | MSAITTKIIEKYNFSSEMSVSNLRQYTSEFLENLTDDRKQNQARRRLQDGFKFSSEQVSILIPNQRSGKTKVINLATSDSYQIPYPT… |
| A0A2I1DTR2 | 169-342 | None |
| A0A397JGD8 | 85-295 | None |
| A0A015NEQ6 | 1-152 | None |
| A0A2Z6R0P3 | 1-110 | None |
| A0A397VDR2 | 15-195 | None |
| A0A397VDH8 | 19-192 | None |
| A0A397S7G2 | 28-175 | None |
| A0A2Z6R0B5 | 5-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.