DPCstruct | MC13223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7N2I4 | 1-76 | MNQDQIALAAELLNMDPQVAAANAYDIRDDIMCTYSDIRGLGSVLVGPDLSVLFFASYVSPEQALQVWDTGRRTPR |
| A0A7M4DPV5 | 7-99 | TEGAATPGQRRLVAIGTALLHRVWPGIALRTFTLTDDDAVLLVQPVRGGVSLFVAADESVMFYASSVEPGAALELFRSGERTDPARF… |
| A0A6I5N0F5 | 23-107 | None |
| A0A1K2FDN5 | 100-197 | None |
| A0A1N6FD63 | 127-226 | None |
| A0A4S2USK6 | 20-101 | None |
| A0A6I2FC08 | 189-284 | None |
| A0A2P8GX20 | 189-280 | None |
| A0A316I161 | 1-84 | None |
| A0A1V2NYS3 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.