DPCstruct | MC13222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 11.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14017 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7EV76 | 86-203 | APAGPPRRPGSARRMFAMTVLVSEVLVVLFATLVAHGLDLADRSAVWGVGGAAMVACAVTAGLLRHRVGYVIGSVVQVLLVVAGLVL… |
| A0A7M4DPF9 | 27-160 | PPATGSGTAPPPARRPQRSARLIFCLTVLTLEVFVVFFATLVAFGLQLSEPGVAWAVGGAGMLVCIVAAYLQKYPIGLVAGYVVQAL… |
| A0A1V3C308 | 2-112 | None |
| A0A4Q2KTU2 | 4-129 | None |
| A0A433FCR0 | 5-128 | None |
| A0A2H1KVW5 | 3-120 | None |
| A0A1H0ZUK1 | 18-160 | None |
| A0A2S6IIY5 | 1-115 | None |
| A0A1L2ZKV0 | 3-134 | None |
| A0A3N1HU20 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.