DPCstruct | MC13221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 22.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S3V6I9 | 2-100 | AALAFLAAGSAKLAGVPMMVEIFDHVGLGQWFRTVTGLIEIVAAVALFIPVTIGLGGLLLAVTMCVAIFTHLFVIGGSPVPAILLLL… |
| A0A7M4DEE8 | 6-138 | CMTSTPAAAPSVARWRDWLLVALIVWLVVSFTAGAVTKFMPGETFFGPPYSVKFENWGYPPWFRFPVGIGELAAAVALLFPRLRFLG… |
| A1ZY83 | 17-129 | None |
| A0A8B5XCI5 | 2-114 | None |
| A0A1Q8JMG6 | 4-126 | None |
| A0A4Q7J8A2 | 10-130 | None |
| A0A849EID3 | 45-165 | None |
| A0A086DU97 | 11-150 | None |
| A0A7G5H511 | 2-117 | None |
| A0A2V9GIG8 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.